SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000229390-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000229390-2
Domain Number 1 Region: 14-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.76e-35
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000229390-2
Sequence length 221
Comment SRSF9 (Homo_sapiens) serine/arginine-rich splicing factor 9
Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRTGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Download sequence
Identical sequences A0A286XY31 G5B772
ENSCPOP00000006141 HGL_H00000229390-2 XP_003478484.1.53824 XP_004843721.1.39548 XP_004843722.1.39548 XP_004843723.1.39548 XP_005396562.1.28644 10141.ENSCPOP00000006141 ENSCPOP00000006141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]