SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000230792 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000230792
Domain Number 1 Region: 264-457
Classification Level Classification E-value
Superfamily Nudix 3.38e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 16-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-18
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000230792
Sequence length 462
Comment NUDT12 (Homo_sapiens) nudix (nucleoside diphosphate linked moiety X)-type motif 12
Sequence
MSSVKGSPKREIIYEFHSAAAEGDMAKLTGLLSHSPSLLDETSENGWTALMYAARNGHSD
VAQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHTANLLANAKGGKKPWFLTNEVEECENY
FSRTLLDRKSEKRNNSDWLLAKESHPSTVYILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDVKDYLAQPEKITLIFLGVELEMNKKLHDHAREVPREEEDQLVAWFALGIDLIAAKEF
KQRHENCYFLHPPMPALLQLREKEAGVVAQARSVLAWHSRYKFCPTCGSTTKIEEGGYKR
VCLKEDCPSLHGVHNTSYPRVDPVVIMQVIHPDGAKCLLGRQKRFPPGMFTCLAGFVEPG
ETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTRGKQQEFFVPPSRAIAHQLIKHWIRMNPNL
Download sequence
Identical sequences G5B9C4
HGL_H00000230792 XP_004841814.1.39548 XP_004841815.1.39548 XP_004841816.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]