SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000234111-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000234111-3
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.91e-72
Family Alanine racemase-like, N-terminal domain 0.00000000079
Further Details:      
 
Domain Number 2 Region: 263-420
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.33e-49
Family Eukaryotic ODC-like 0.000000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000234111-3
Sequence length 461
Comment ODC1 (Homo_sapiens) ornithine decarboxylase 1
Sequence
MNSSRSEEFDCYFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRAIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAASSGVQMMTFDSEVELLKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRVL
LERAKELNIDVIGVSFHVGSGCTDAETFVQAVSDARCIFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPVDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVWREQ
ASSDDEEEASEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEVHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSRPAWQLMQRV
QNHGFLPGVEEQDVGALPVPCACESEMKRHPAARTSASINV
Download sequence
Identical sequences G5B588
XP_004870020.1.39548 HGL_H00000234111-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]