SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000234111-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000234111-4
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.76e-53
Family Alanine racemase-like, N-terminal domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 241-286
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000181
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000234111-4
Sequence length 288
Comment ODC1 (Homo_sapiens) ornithine decarboxylase 1
Sequence
MNSSRRQEFDCYFLDEGFTAKDILDQKINEVSSSDDKDSFYVADLGDVLKKHLRWLKALP
RVTPFYAVKCNDSRAIMKTLAAIGMGFDCVSKTEIQLVQSLRVPPERIIYANPCKQASQI
KYAASSGVQMMTFDSEVELLKVARAHPKAKLVSRIATDYSKLSVASVFHVGSGCTDAETF
VQAVSDARCIFDMGAEVGFSMHLLDIGGDLPGSEDVKLKFEEVTSVINPALDKHFLVDSG
VCIIAEPGRYYVASAFTLTVNIIAKKLVWREQAGSDNEEEASEQTFMY
Download sequence
Identical sequences G5BC60
HGL_H00000234111-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]