SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000234389 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000234389
Domain Number 1 Region: 328-354,392-496,610-725
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.67e-50
Family Phosphate binding protein-like 0.0000966
Further Details:      
 
Domain Number 2 Region: 204-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000194
Family L-arabinose binding protein-like 0.0051
Further Details:      
 
Weak hits

Sequence:  HGL_H00000234389
Domain Number - Region: 487-586
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00353
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000234389
Sequence length 938
Comment GRIN3B (Homo_sapiens) glutamate receptor, ionotropic, N-methyl-D-aspartate 3B
Sequence
MGSISQTVAPKRRPALTRNFAMEFVRALWLGLALALGMKPARGHPHPCGVLARVGGSTPF
HLQLDWASPLETLLDVLVSVLQAHTWEDVGLALCRVRDPSTLVALWTSRAGRAPRLVLDL
SQPDIGDAGLGVRLATLRTPVGGDTPVSTVVLLGCDAAHAGQVLEAAPPGPHWLLGTPLS
PEALPTPTASLPPGLLALGEVARPPLEAAIQDAVELVAQALGSAAQVQPERTLLPAAVSC
DDPQPAGPESRGRLLARFLANTSFQGLTGPVWVTATSEVHMSRQFRVWSLRQDPLGTPAW
ATVGSWRDGHLDLDPGVVAARPLPPPGTQARSKLRVVTLIEHPFVFAREPDEDGQCPAGH
LCLDPGTNDSATLDTLFAALANGSVPRALRKCCYGYCMDLLERLAEDAPFAFELYIVGDG
KYGALRDGRWTGLVGDLLAGTAHMAVTSFSINSARSRVVDFTSPFFSTSLGIMVRTHDTA
SPIGAFMWPLHWTMWLGVFAALHLTALFLTLYEWRSPYGLTPRGRNRSTVFSYSSALNLC
YAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDP
KLHHPPQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPGGVAMLTSDPPKLNAFI
MDKSLLDYEVSIDPDCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLL
HDKWYKMVPCGKRVFAVTETLQMGIYHFSGLFLLLCLGLGSALLSSLGEHFFYRLVLPRI
RRGNRLQYWLHTSQKIHRALNTDRPLAQEKREAESSGPEERQQATQAAPKSPGRWKHVRR
AVGTERRRVRFLLEPAVAAAQDTEPRPPESSVWLCSNGQSPAPRPGELEELEQHIEAVRE
RLRQALLRRGELRAQLGDGTRHRPLQLLQASTVLEEAR
Download sequence
Identical sequences G5C5Y1
HGL_H00000234389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]