SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000236925 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000236925
Domain Number 1 Region: 886-929
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0000000000000439
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00036
Further Details:      
 
Domain Number 2 Region: 1018-1121
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000165
Family Rhodopsin-like 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000236925
Domain Number - Region: 260-300
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000464
Family Calponin-homology domain, CH-domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000236925
Sequence length 1142
Comment CAMSAP1L1 (Homo_sapiens) calmodulin regulated spectrin-associated protein 1-like 1
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQERL
VTERDLHKKPIQMDKWIVTKHIDEFVDLCLVVALSDTDRYVLDDLVVRKSAHLAMIDTLM
MAYTVEMVSVEKVIACAQQYSAFFQATDLPYDIEDAIMYWINKVNEHLKDIMEQEQKLKE
HHTVEAPSGQKARYRKEQTLLKQLPCIPLVENLLKDGTDGCALAALIHFYCPSVVRLEGG
IRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRPTPNRGITRSISNEGLTL
NNNRLPKHIRKNLSFKPVNGEEEAESIEEELNIDPHSDLRSYMPLNTNELNSNENMHYKL
PNGALQNRVLLDEFGNQIETPSIEEALQIIHDTEKSPCTPRPDQIANGFFLHSQEMSILN
SNIKLSQSSPDNLTDTKGALSPITDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSD
MDDASKFLQDYDIRTNNPREASSPCPSTVSNKSQPGSSASSSSGVKMTSFAEQKFRKLNY
TDGKSSGSSSQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEE
KRRAIEAQKKKMEAAFTKQRQKMGRTAFLTVVKKRGDGISPLREEAAGAEDEKVYTDRAK
EKESQKPDGQRSKSLADIKESMENPPTKWLKSPTTPVDSEKQWNLASPSEENLNEGEILE
YTKSIEKLNSSLHLLQQEMQRLSLQDDQKAENDMAMKRAALMEKRLRREKETQLRKQQLE
AEMEHRKEETRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAK
SNKHIIQNALAHCCLAGKVNEGQKKKILEFHSQKFLQNMRIQRPFVHSPLCDLVGFGIAL
PPPPPYRGLNSGPQARQAVEPLAKSPGFGINHHLFRFSKLPKDMGTSQRELPNLCVGRAP
RNSLRIIFAVEGSFVGSWLPLSALRAVFHLARLRALPLPCPLVLALRWGLTVATCLAFVN
SCANPLIYLLLDRSFRARALHRACGRAGRPVRRVSSASSLSRDDNSVFWGRSQTLNAASA
AW
Download sequence
Identical sequences G5B3B0
HGL_H00000236925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]