SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000237353 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000237353
Domain Number 1 Region: 750-855
Classification Level Classification E-value
Superfamily Tropomyosin 0.000036
Family Tropomyosin 0.0053
Further Details:      
 
Weak hits

Sequence:  HGL_H00000237353
Domain Number - Region: 582-638
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000139
Family Intermediate filament protein, coiled coil region 0.0046
Further Details:      
 
Domain Number - Region: 473-733
Classification Level Classification E-value
Superfamily Tropomyosin 0.00608
Family Tropomyosin 0.00048
Further Details:      
 
Domain Number - Region: 249-283
Classification Level Classification E-value
Superfamily YAP1 redox domain 0.0732
Family YAP1 redox domain 0.0061
Further Details:      
 
Domain Number - Region: 98-221
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000237353
Sequence length 1043
Comment PMFBP1 (Homo_sapiens) polyamine modulated factor 1 binding protein 1
Sequence
MLKLKGELRASKGLKGEVGERDREVESLNSKLLSLQLDIKNLHDVCKRQGKTLQENQLCV
EEAMMNSSHNRKQAQTLVIEESQIDFGSAKECHLRQLQQLKKKLLALQQELEFRTDELQT
SYCSLLQYQSILEKQTFDLVLLHHHCKLKEDEVILYEEEMGNHNENTGEKLHLAQEQLAL
AGDKIVSLERSLNLYRNKYHTSLSNIELLECQVKMLEGELSGLISQEPENTGDHPKVHIY
TSSCMIQEHQETLKQCSEVWQKVSEQDDLIQELRNKLACSNALVLEREKALIKLQADFAS
YTATHRHPPSSSEDCEDIKTILKHLQEEKDSQCLHVEEYQNLVKDLRMELEAVSEQKKNI
MKGKQDMMKLELELHGLRGETSAHIERKDKETTILLHQLQELQLQFSETQKLALKKDKLL
QEKDKMLHELEKKLSHIQNYFRKKEMELESQQCITKELEMTRKEANKDESKVECEALKAD
VQKLTDSLEEAKQQQRLAAQQAAQYKEKTRLAEQNLDGVEKKLQSCIYEDKQKANTIQEQ
QRELQKLQKESLLAEEELSHNRKRVEELTSEVAEILKKLENADKERRKLQKTVAEDEVKI
NELQDQARHFQHQHKDLLSAKSKLEDDIQEVRKLLEEKKEQLKKSKEQEKLLEEELEVVR
QEEKKKDKMLKEKLRKLEEENENLREELVHYSTQLEASISKYNATQQVIQELNIQITHQK
VSIMSLKTQLEQAVKKENHYLQTMVTKEVYEDLSRKSAACQDDLTQALEKLNHATSETKS
LQRNLLQTQERKTQLEDEILAYEERMKKLNVELKKLQGFHQESEIEVHAFDKKLEEMSNQ
VMQWQKQHQNDLKMLAAKETQLREFQEEMATLKENLLADEKEPCCLPPRSVPKDPCRLHR
DNDQIMCNMEQWAKEQKITNEKLGNKLREQVKYIAKLTGEKDHLHNVMVHLQQENKKLKT
EIEEKKMKAENTRLCRALGPSKLEPTQRGKVCGALGWRGTAQDTGWRMGITKYVGMPQCS
GTSAMSFVTVMFPFLVPCAKTTV
Download sequence
Identical sequences G5B5U9
HGL_H00000237353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]