SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000237596 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000237596
Domain Number 1 Region: 455-591
Classification Level Classification E-value
Superfamily EF-hand 0.00000000235
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 285-338,375-499
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000011
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000237596
Sequence length 781
Comment PKD2 (Homo_sapiens) polycystic kidney disease 2 (autosomal dominant)
Sequence
MESDAQGWNQAGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSHVY
YYTRTMSQLFLDTPVSKSEKTNFRTLSSVEDFWKFIEGPLLDGLYWKAQPGNHSEVDNRS
FIFYENLLLGVPRIRQLKVRNGSCSIPLDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWI
YTSEKDLNGSTHWGVIAAYSGAGYYLDLSRTREETAAQLAGLRKNVWLDRGTRAAFIDFS
VYNANVNLFCVARLLVELPATGGVVTSWQFQPVKLIRYITAFDFFLAACEIIFCFFVLYY
AVEEILEIRIHKLHYFRSFWNCLDVVIVVLSGIAIGINIYQTSSVEGLLYFLEDQNTFPN
FEHLASWQIQFNSIAAITVFLVWIKLFKFISFNRTMSQLSTTMSRCAKDLFGFALMFFII
FLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDVNFAEIEEANRVLGPLYFTTFVFF
MFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISE
SLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKERE
DLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVD
RMEHSIGSIVSKIDAVIVKLEIMEQAKLKRREVLGRLLDGVAEDERLGRDNDIHREQMER
LVREELERWESDDAASQLSHGLGTPAGLSGQPRPRSARPSSSQSADGLEGEGGNSSSNIH
V
Download sequence
Identical sequences G5BSU1
HGL_H00000237596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]