SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000240123 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000240123
Domain Number 1 Region: 385-451
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 445-535
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-20
Family SH3-domain 0.00067
Further Details:      
 
Domain Number 3 Region: 584-668
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000240123
Sequence length 669
Comment SORBS3 (Homo_sapiens) sorbin and SH3 domain containing 3
Sequence
MQGPPCSLPARLSLDDFIPAHLRAHVGPSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCN
GYIPATRDAPRHPDPAWYQTWPGPGSRPSASPKMPTSQHGQNWSATWTKDSRHRDKRWVK
YEGIGPVDESGMPIAPRSSVGSPRDWYRRMFQQIHRKMPDLQLDWTFQDPPRDPRHPGPQ
QRAAPRSGMAAASRGRSWDRSQELPGSTFNYTPGAGSLGLRPPNQVLRRQEKVDNVWTEE
SWNQFLQELETGQKPKKPLVDDPVEKPSQPIEVLLERELANLSAELDKDLRAIETRLPSP
KVPAPRQVAQSPCPCSPAPAWSSGSPHAPYLGSSRPLSPHRMADGGGSPFLGRRDFVYPS
SAQDPRAPEQGGSPARKEEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG
EHHGRRGIFPANHVEVLPADEVPKPIKPPTYQVVEYGEAVAQYTFKGELEVELSFRKGER
ICLIRKVNENWYEGRITGTGRQGIFPASYVQVCREPRLRVCDDGPQLPASPRLAPAARLA
RRPGSPSAPRSPADPADRGGRASPRRTGFSAPSQEPRPQSQSLSTSRPALLHPPGPSHPS
DTSFPNTTQIHWTPYRAMYQYRPQNEDELELRAGDRVDVMQQCDDGWFVGVSRRTQKFGT
FPGNYVAPV
Download sequence
Identical sequences G5B9Q7
HGL_H00000240123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]