SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000240361 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000240361
Domain Number 1 Region: 269-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.61e-34
Family Protein kinases, catalytic subunit 0.0006
Further Details:      
 
Domain Number 2 Region: 25-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-22
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000240361
Sequence length 1478
Comment TEX14 (Homo_sapiens) testis expressed 14
Sequence
MSRAVRLSVPCPVRLGTLRNDSLEAQLHEYVKQGNYVKVKKILKKGIYVDAVNSLGQTAL
FVAALLGLTKFVDILVDYGSDPNHRCFDGSTPVHAAAFSGSQWILSKLLDAGGDLRLHDE
KGQNPQTWALAAGKDRSTPMVEFMQRCTSHMQAIMQGFSYDLLKKIDSPQRLICNPPSLA
GFLQGSPNGSPNQPLKAGVISTQNIYSFGFGKVRFDAVLWFQFYLTGGTQLAYLGSLPII
GEKEVIQADDEPTFSFISGPHMVMTNLVWNGSRVTVKSLNLPTHSSRLRLADLLIAEQEH
SSKLRHPHLLQLMAVCLSQDLEKTRLVYERITIGTLFSVLHERRSEFPVLHMEVMVHLLL
QIADALRYLHSRGFVHRSLSSYAVHIVCAGEARLTNLEYMLESQGSGRHRDLHQVPLPTE
LYNWASPEVIFQKAATVKSDIYSFSMIIQEILTDSVPWNDLDGSVIKEAILLGNYLDADV
RLPKPYYDVVKSGIQVKQKDRTMNLQDIQYILKNDLKASPEVLGTQRTQPVESPRVQRCE
PYPDVSVYLGLTSEHPKASADLEIKELKESGSQPHSPRGHSSPTAKAALAPQAPDPHLKA
QVSQNPDAPPPSAPFVAETKSPSAGQDGLHSFEINEIYSGCLNVGDDPEEECPGGTSARE
GGKPNQADELPSLEEELDKMEEEAHLCDEDESSSEADTEIFFGDWDWQNSSLSLLSLPEP
TKEAKGKVSSWSKTEEYISKCVLNLKISQTMAHEITDLVGNIEQKLDKVELIQKKHISLW
TASRLFPDVCDLPRAVGPPTLNYIHPVMQVSGGPQPDTNGSCPTLPSTEMWLLFFKLSTL
CDPGKQDTGEPFQATQGAKDCLEKKKNQDSSSVVSPPAAQAQGPEFDPWYQKKKKSALFP
SSNRAEGPSESSCSCPRINVESMSSVISNVKSENKDDGKIHLKWKMEVKETAEKAASGEL
PVLPWHPQSSSTSKSEAVHWSRPLLQPPARGPKNMDWQRTVEFHREKEEPGGNDVKWGKM
DNCDHDGEKCGRQPGPQSFTSIRHLSSRKNEQPEPSEAFQASSDMSVTTEKSYNDQATLS
SCSPESSEDRTDEFLTPDHEYFYSLAAQENLPLETSSPIEENIEGIEGAFAQPQGYGEEK
FQMKQILGKNTEMFTRSQSLQSTECEQEALKEPLKELKEKDISLTDIQNLSSISYEPDGF
FKETSCETPKVSHTPTSVSTPLGPDLESEVSKMKTQEESNKIQLENYRQLYLEEFIRRES
LFSKLNKANESLEEANNKLLVEQQQNRSLLSTVSTRPVLECPCVRNLNHMEAISQQQIEE
LPAPSQELLEEIEQLKQQQASSMVLHGNTAHHPSVTADDPKHLEEQETDSNKEDSSLLWT
RELQDLGEDIERAHSTLDEDLERWLQPPEEKNIELQDLCKVFKRDAETKDQDFGEKRTKR
KESIKPEIRKSENFLGICDEDELKPCFWKRRGWSEPSR
Download sequence
Identical sequences G5AXZ0
HGL_H00000240361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]