SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000243346-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000243346-2
Domain Number - Region: 104-222
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00393
Family Canonical RBD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000243346-2
Sequence length 308
Comment NMI (Homo_sapiens) N-myc (and STAT) interactor
Sequence
MEPDQDNKNQVLKEQQLDEKSMNDEQNEGLLDEIRKKNIQLQEEIQKLEAKLQEPTKDFQ
IKEDIPETQMTFTSLENPENDSQFLNISCSFQVSSQVSYELQEGQALITFEKEEVAQNVI
RMGKHQVWIKDVNVAVTAKPVPLNAGVKFQVHVEVSQVKINVTEIPDGLPEDQMRDKLAL
SFSKSRNGGGEVESVEYDKQSRSAVITFVDTGVTDKILKKKDYPVYINQSCHTVDVSPYI
EKRLQKYQVFSGISKRTVLLTGLEHIRMDEETVEDLVSIHFQREKNGGGEVEVVKCSLGQ
PHTAYFEE
Download sequence
Identical sequences G5B7R9
HGL_H00000243346-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]