SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000243457 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000243457
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 4.67e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-25
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000243457
Sequence length 427
Comment KCNJ2 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 2
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFVN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALRSKEEDDSENGVPESTSTDTPPDLDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences G5AV38
XP_004860616.1.39548 HGL_H00000243457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]