SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000244458 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000244458
Domain Number 1 Region: 17-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-73
Family FCH domain 0.0017
Further Details:      
 
Domain Number 2 Region: 388-423
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000948
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000244458
Sequence length 424
Comment PACSIN1 (Homo_sapiens) protein kinase C and casein kinase substrate in neurons 1
Sequence
MSGSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQL
TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNSLLSEDLEKVKNWQKDA
YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLALTREMNSKGE
QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLDDVGKNTPQYMESMEQVFEQCQQFEEK
RLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWP
QFEEWNPDLPHTTAKKEKQPKKVEGAALSNAAGAVECTSQAGDRGRTKAPGAGWRVAQQR
EGPGGFTPRVRGGRANLAPVHCHPFPFPGDELTKLGEEDEQGWCRGRLDSGQLGLYPANY
VEAI
Download sequence
Identical sequences G5BCG0
HGL_H00000244458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]