SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000244751 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000244751
Domain Number 1 Region: 163-294
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-25
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 2 Region: 21-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.48e-21
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 3 Region: 326-511
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000267
Family Integrin A (or I) domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000244751
Sequence length 595
Comment CPNE5 (Homo_sapiens) copine V
Sequence
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSSGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILAAEELSNCRDVAT
MQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALC
NGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVINPKKKMKKKKYVN
SGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYA
LALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLVGVRRKEGLGSGACLVARAA
RGVQGSRESGGRSWEAWGAAVTQLCPARSAAAVQDGSQYSVLLIITDGVISDMAQTKEAI
VNAAKLPMSIIIIGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNH
VLSMARLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPTHSPPKAPARTTPESPLH
Download sequence
Identical sequences G5B539
HGL_H00000244751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]