SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000245255 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000245255
Domain Number 1 Region: 410-862
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.92e-128
Family PIWI domain 0.0037
Further Details:      
 
Domain Number 2 Region: 113-434
Classification Level Classification E-value
Superfamily PAZ domain 1.73e-87
Family PAZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000245255
Sequence length 862
Comment PIWIL1 (Homo_sapiens) piwi-like 1 (Drosophila)
Sequence
MTGRARARARGRARGQDEAQHMGAALSQQPGYPQPRLPHPLAEGDLVGRGRQRGAAGATA
KSQELQISAGFQELSLAERGGRRRRDFHDLGVNTRQSLDHVKESKTGSSGIKVRLSTNHF
RLTSRPQWALYQYHVDYSPLMEARRLRSALLFQHEDLIGRSHAFDGTILFLPIRLQHKVT
ELSSLTRNGERVRITIALTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPHDPI
DIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMLNLYHQTEGHKFQEQV
AKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYQQQYNQEITDLKQ
PVLVSQPKRRRGPGGTMPGPAMLIPELCYLTGLTDKMRNDFTVMKELAAHTRLTPEQRQR
EVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYSPQFADWS
KETRGAPLISARPLDNWLMIYTRKNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVDDRTE
AYLRVLRQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTAMA
IATKIALQMSCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWF
SRCVFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQ
FLDCLKSLGRGYSPRLTVIVVKKRVNARFFAHSGGKLQNPLPGTVIDVEVTRPEWYDFFI
VSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHIYYNWPGIIRVPAPCQYAHKLA
FLVGQSIHREPNLSLSNRLYYL
Download sequence
Identical sequences G5AWP4
HGL_H00000245255 XP_004844045.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]