SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000245503 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000245503
Domain Number 1 Region: 59-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-289
Family Motor proteins 8.63e-18
Further Details:      
 
Domain Number 2 Region: 1248-1366
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.18e-29
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number 3 Region: 851-976
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-26
Family Myosin rod fragments 0.00000169
Further Details:      
 
Domain Number 4 Region: 974-1084
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.18e-24
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 5 Region: 1443-1565
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000144
Family Myosin rod fragments 0.0066
Further Details:      
 
Domain Number 6 Region: 1082-1196
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000123
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number 7 Region: 1725-1947
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000281
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  HGL_H00000245503
Domain Number - Region: 1579-1673
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0102
Family Myosin rod fragments 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000245503
Sequence length 1949
Comment MYH2 (Homo_sapiens) myosin, heavy chain 2, skeletal muscle, adult
Sequence
MSADSEMAVFGEAAPFLRKSEKERIEAQNRPFDAKTSVFVAEPKESFVKGTIQSREAGKV
TVKTEAGATLTVKDDQVFPMNPPKFDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPEVVGAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGDKKKEEQTSGKIQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYPFVSQGEISVPSIDDQEELMATDSAIDILGFTNDEKVSIYKLTGGVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQGLNSADLLKALCFPRVKVGNEYVTKGQTV
EQVVTSLPFKVTNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFD
FNTLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMG
IFSILEEECMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKVEAHFSLIHYAGTVDYN
INGWLEKNKDPLNDTVVGLYQKSSLKTLANLFSGAQTAEAEASGGAKKGGKKKGSSFQTV
SALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRK
GFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKA
GLLGLLEEMRDDKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNIRAFMNVKHW
PWMKLFFKIKPLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVSLLKEKNDL
QLQVQAVCWGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLLEDE
CSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQT
LDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESI
MDIENEKQQLDEKLKKKEFEMSNLQSKIEDEQAVSIQLQKKIKELQARIEELEEEIEAER
ASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHE
ATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLE
KMCRTLEDQLSELKSKEEEQQRLINDLTTQRGRLQTESGEFSRQLDEKEALVSQLSRGKQ
AFTQQIEELKRQLEEEVKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANS
EVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVE
DLMLDVERTNAACAALDKKQRNFDKVLAEWKQKYEETHAELEASQKEARSLGTELFKMKN
AYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEE
AEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEME
AGNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQED
LKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINT
KKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNM
EQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERR
VKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLSKFRKLQHELEEA
EERADIAESQVNKLRVKSREVHTKVISEE
Download sequence
Identical sequences G5B5I4
HGL_H00000245503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]