SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000245539-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000245539-4
Domain Number 1 Region: 34-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.09e-49
Family Ribosomal protein S7 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000245539-4
Sequence length 242
Comment MRPS7 (Homo_sapiens) mitochondrial ribosomal protein S7
Sequence
MAAPVLKALRSGLGLVPGVTCAVWRVPGPAQVRWSRYGPEFRDPLVDKEHYRKPETELTE
EEKYDQELKKTQLIKAAPATTTCSVFADPVISKFTNMMMKGGNKILARSLVTQTLEAVKR
KQFEKYHAASAEEQATIERNPYIIFHQALKNCEPVIGLVPILKGGHFYQVPVPLPDRRRR
FLAMKWMITECRDNKHRRTLMPEKLSHELLQAFHNQGPVIKRKQDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences G5BNB9
XP_004860708.1.39548 HGL_H00000245539-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]