SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000246071-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000246071-2
Domain Number 1 Region: 63-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000244
Family Canonical RBD 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000246071-2
Sequence length 143
Comment SNRPB2 (Homo_sapiens) small nuclear ribonucleoprotein polypeptide B
Sequence
MRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTANKKPGQGTSTTDTQGNAT
PNPQVPDYPPKYILFLNNLPEETNEVMLFNQFPGFKEIHLVPGRHDIAFVEFENDGQAGA
ARDALQGFKITPSHAMKITYAKK
Download sequence
Identical sequences G5C1R4
HGL_H00000246071-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]