SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000246194-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000246194-3
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.32e-20
Family Canonical RBD 0.00000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000246194-3
Sequence length 321
Comment RALY (Homo_sapiens) RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))
Sequence
MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVAGCSVHKGYAFV
QYSNERHARAAVVGENGRVLAGQTLDINMAGEPKPNRPKGLKRAASAIYSGYSFDCDYYR
DDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAMTTGSTKI
KLKSSELQTIKTELAQIKSNIDALLGRLDQIAEEQKANPDGKKKGDNSSGAGGGNGSGSG
GSGGGGGGGGGGGGSGSGSGSSGGGGSSRPPPPPEDTPSEAGTPQEEAQTRDDGDEEGLL
THSEEELEHSQDTDAEDGALQ
Download sequence
Identical sequences G5BPU0
HGL_H00000246194-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]