SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000246801 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000246801
Domain Number - Region: 155-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.000883
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000246801
Sequence length 565
Comment TSKS (Homo_sapiens) testis-specific serine kinase substrate
Sequence
MASVVVKTIWQSKEFHQAGDTPARVERRIQLGPEAPGSMTGPAKGVRKKKKAVSFHSVEP
RTPHEPVDWCLNLRRSSGCTNVSLLNLAAAVEPWDSSGTNCITEDSGPLELPGPPAAPAP
PWAADDPDIKELLSGLNSGLVHAKDSVISLKEKTSWVNQHVQTLQSECSLLSENLERRRQ
EAEELEGYCSQLKENCKKVTRSVEDAEIKTNVLKQNSALLEEKLRYLQQELQDETPRQEV
EMQELEQKLEASLSHSGLSGNPEEAARLRSTAPGGCGTGPGAGETPHTSEQELQKVSASL
EDLRREVSSLAARWHQEEGAVQEALRLLGGLGGRLDGFMGQWERAQCDQTQTARSLQELR
RQADQLCTLVERSAVSLASLRSELEGLGPVKPILEELARQFRNSQRVPDHSMNPDRSSQG
SCARCASQGQQLSMESLQHLLERALTPLVDEVKQRNLTPPACPSCQRLHKKILELERQAL
AKHIRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKVATLDYLHLKMCSLHDQLSNLPL
EGSTGTMGEGSGGAAPKCGSPAPKQ
Download sequence
Identical sequences G5B8Q6
XP_004866945.1.39548 HGL_H00000246801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]