SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000248929 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000248929
Domain Number 1 Region: 94-260
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0054
Further Details:      
 
Domain Number 2 Region: 240-356
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.18e-23
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 479-541
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-18
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 4 Region: 561-593,630-715
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000589
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000248929
Sequence length 748
Comment SGSM3 (Homo_sapiens) small G protein signaling modulator 3
Sequence
GAHIPSSSGPFSALTPSIWPQEILARSTQKEDSAEQSEFCYDEFGFRMDNEGAEPGSSPL
MEAALVEDPPQRLRWQAPLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHSMRPQ
LWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVP
RLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLL
GVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDLFF
YEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGEAMHLAGSLT
DVAVETQRRKHLAYLIADQGQLLGTSAATNLSQVVRRRTQRRKSTISSLLFGEDDLEALK
AKNIKQTELVADLREAILRVAHHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHR
RRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSK
EYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKRPSLLGGACHPWLFIEEAAGREVER
DFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGL
NEQVLHLWLEVLCSSLATVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAK
REEEKQPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences G5AYW5
HGL_H00000248929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]