SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000249750 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000249750
Domain Number 1 Region: 99-574
Classification Level Classification E-value
Superfamily ALDH-like 9.03e-183
Family ALDH-like 0.0000000000000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000249750
Sequence length 579
Comment ALDH1A2 (Homo_sapiens) aldehyde dehydrogenase 1 family, member A2
Sequence
MTSVRQSGIELSIASDFCSWRTNILKRGRFQTPVGTQMTVAVSKTGSLHHCLGVELGRGP
RVLRIRATGGSVEKSKEASRGAREAGPSPQDDRAATSGFGIFINNEWQNSESGRVFPVYN
PATGEQVCEVEEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAI
LATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGV
CGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINIL
PGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADA
DLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQ
GPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIF
GPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNA
QSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences G5B126
HGL_H00000249750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]