SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000250113 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000250113
Domain Number 1 Region: 200-288
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000577
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  HGL_H00000250113
Domain Number - Region: 161-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000531
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 
Domain Number - Region: 41-157
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00963
Family MBT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000250113
Sequence length 586
Comment FXR2 (Homo_sapiens) fragile X mental retardation, autosomal homolog 2
Sequence
MWSRDCPSRCVAPTGPSTSWQSERQIPFGDVRLPPPADYNKEITEGDEVEVYSRANEQEP
CGWWLARVRMMKGDFYVIEYAACDATYNEIVTLERLRPVNPNPLATKGSFFKVTMAVPED
LREACSNENVHKEFKKALGANCIFLNITNSELFILTSKQLAAAFQEEFTVREDLMGLAIG
THGANIQQARKVPGTPEACRQARSYLEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGV
VRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQALLEYHLSYLQEVEQLRLERLQIDE
QLRQIGLGFRPPGSGRGGGSDKTGYTTDESSSSLHTTRTYGGSYGGRGRGRRTVGSAYGP
SSDPSTASETESEKREEPNRAGPGDRDPPTRGEESRRRLIGGRGRGPPPTTRPTSRYNSS
SISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPPASASRSRRRRTDEDRTIMDGGLESD
GPNMTENGLEEESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPP
LELAKPSEDSLSGQKGDSVSKLPKGPSENGELSTPLELGSLVNGVS
Download sequence
Identical sequences G5B5D2
HGL_H00000250113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]