SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000250416-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000250416-2
Domain Number 1 Region: 359-573
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.4e-76
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 225-357
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.03e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000394
Further Details:      
 
Weak hits

Sequence:  HGL_H00000250416-2
Domain Number - Region: 59-157
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.00379
Family MukF C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000250416-2
Sequence length 577
Comment PARP2 (Homo_sapiens) poly (ADP-ribose) polymerase 2
Sequence
MPWATSHSGSGSGSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPATQHPASGTGTVQTEAI
KQILEVIDKKLRNLEKKKERMNEGERLNQDQLDAVSKCQEVTNNLEFAKELQRSFMALSQ
DIQKTIKKTARQEQLMREEEAQKRLKTVLELQYVLDKLGDDEVLTDLKQGLTGVPILSEE
ELSLLDEFYKLVDPEQDMSLRLNQQYEDDNKTKQEDSLKSPLKPESQLDLRVQELIKLIC
NVQTMEEMMIEMKYDTKKAPLGKLTAAQIKAGYQSLKKIEDCIRAGQHGRALLEACNEFY
TRIPHDFGLRTPPLIHTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQCYRNLH
CTLHPLDHESHEFTVISQYLQSTHAPTHRDYSMTLLEAFEVEKEGEKEAFREDLPNRMLL
WHGSRLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRVKNTGLLL
LSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSPAHFITLNGSTVPLGPASDTEI
LNPGGYTLNYNEFIVYNPNQVRMRYLLKIQFNFLQLW
Download sequence
Identical sequences G5B0T6
HGL_H00000250416-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]