SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000250693 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000250693
Domain Number 1 Region: 37-280
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.28e-68
Family Ecto-ART 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000250693
Sequence length 325
Comment ART1 (Homo_sapiens) ADP-ribosyltransferase 1
Sequence
MQVPAMLSLLLVSVGLSDALQVQRHSITRRDIFPQETLLDMALASFDDQYSGCAAAMTAA
LPELNHTEFQANKVYAEGWALASSQWQEHQAWEPEWGLSTTRPPPPPPGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAQYLQHFSFKTLHFLLTEALQLLGTGQRPPRCHQVYRG
VHGLRFRPVGPGATVRLGGFTSASLKNVAAQQFGEDTFFGIWTCLGAPIRGYSFFPGEEE
VLIPPFETFQVINASRPAQGPAHIYLRALGKRSMYNCEYIKDKKCKSGPCRLDGSATCQG
SLFTVWSLLLLLWFLEALPASPDLL
Download sequence
Identical sequences G5AVS6
XP_004863503.1.39548 HGL_H00000250693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]