SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000250894 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000250894
Domain Number 1 Region: 965-1072,1102-1197
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000391
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000250894
Domain Number - Region: 519-572
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00144
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 40-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0209
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000250894
Sequence length 1480
Comment MAPK8IP3 (Homo_sapiens) mitogen-activated protein kinase 8 interacting protein 3
Sequence
MMEIQMDESGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDSLEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGTSQTESSLPGRSRKERPTSLNVFPLADSMVRAQMGGKLMPAGDHWHLNDLG
QLQSSSSYQCPHDEMSESGQSSAAATPSTSGTKSNTPTSSVPSAAVTPLNESLQPLGDYG
SGTKNSKRAREKRNSRNMEVQVTQEVRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRL
DRTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLL
ENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKR
VKSEAVIARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMEL
QEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTA
ASFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQALA
GALPAKYKQLSPSGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWKPSEEDS
GNGVKPMPGRDPLTCDQEVEDEPKSNHTSPERKKAKDLPETDATSSRVWILTSTLTTSKV
VIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDMNPEDSSTDGVLAG
ITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVAATANGKVNPSQSTEEATEATEVPDPG
SSEPEAAAVRPGPLTEHVFTDPAPAPPSSTQPGSENGPEVDGNSVQPQPEPTGDPSAAGS
SAAPTMWLGSQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH
RGEDGQWDLTNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEASADQQC
QGREAKWGTTQRNCSFVQRHGQKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHA
HTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITGLLIAGNRLWVGTGNGVVISIPLTETVV
LHRGQLLGLRANKTSPTSGEGARPGGVIHVYGDDSSDKSASSFIPYCSMAQAQLCFHGHR
DAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAVDTEGQKLKNALVLSGGEGYIDFRI
GDGEDDETEEGAGDISQVKPMLSKAERSHIIVWQVSYTPESSSQVFLPRVHLLCMLPMGV
GSLGPQALALRNVLATLNGSVLDSPSEGPGPAAPAVDTEGQKLKNALVLSGGEGYIDFRI
GDGEDDETEEGAGDISQVKPMLSKAERSHIIVWQVSYTPE
Download sequence
Identical sequences G5BY69
HGL_H00000250894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]