SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000251102 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000251102
Domain Number 1 Region: 874-1070
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-46
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 640-865
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-26
Family Voltage-gated potassium channels 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000251102
Sequence length 1138
Comment CNGB1 (Homo_sapiens) cyclic nucleotide gated channel beta 1
Sequence
MLGWVHKVLPQPPGTPQKTKMQEEEEAEAEPELVLEPEAEPEPEPEAAPEEAKPEGESLP
PEEPAHEEQVAAADSSLQETQEAAPPLPTALQAQVTVAPDVYSSSGWVLTWLRKSMEKVV
PQPAWSGRMAQNGVADTGAPAEVCRGWRLRRGQLESSGWLKQNLEKVLPQPPKLPEVSVE
GEGVFSSCSPCCLEPLGPTLEMEPTESPSLPSPGSLEPEVEPTAEPQPSFQASSLTPPRD
PARLIAWLLHRLEMALPQPVIHGKTGEQQLRSSEMCDVQTLSILPTEQVDSDLVLEEVDP
HWEDAEQDSSTSPQGTEAALVFEEENEAVIEMPRELSLTQEEKEEEEDVEEEEEEEEEEE
QGPDVLLDSCLVGRVGVDQSNLSKTQCQKASLQRTDEGKDSKRREMEEQQGTLQHPAFPR
TQPGPGDLLFCLFDPIPPSSPQVPATEEHPEVQVEDTDPNSHPLIEEEKPSSPGLPPHSP
AKSDTLAVPGSASGPHRKRLPSQDDGAEELKAMSPAESPVVTSSDPTTPQEADGQDRAAS
TASQNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPAPVTKP
AEVEPAEEEHYCDMLCCKFKRRPWKKYQFPQSIDPLTNLMYILWLFFVVLAWNWNCWLIP
VRWAFPYQTPSNIHLWLLMDYLCDLIYLLDITIFQIRLQFVRGGDIIMDKKDMRNNYLKS
RRFKMDVVCLLPLDFLYLKFGVNPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTT
AYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPQTL
FEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQN
RVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYDIVSKVALFQGCDRQMIFDML
KRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVMLKAGSVFGEISLLA
IGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRNNNKPKEQKS
VLILPPRAGTPKLFNAALAAAGKMGKGGKGGKLAHLRARLKELAALEAAARQQQLLEQ
Download sequence
Identical sequences G5AUF7
HGL_H00000251102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]