SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000251287 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000251287
Domain Number 1 Region: 174-354
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-50
Family cAMP-binding domain 0.00000000966
Further Details:      
 
Domain Number 2 Region: 5-154
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-16
Family Voltage-gated potassium channels 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000251287
Sequence length 745
Comment HCN2 (Homo_sapiens) hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Sequence
MTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSNCWVSINNMVNHSWSELYS
FALFKAMSHMLCIGYGKQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQ
YQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREYKQVEQY
MSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFA
NADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSY
FGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKK
NSILLHKVQHDLSSGVFNNQENAIIQEIVKYDREMVQQAELGQRVGLFPPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPARSPSQRAAPSS
STGTRGGHPGHAGRRGGEAGSPPSR
Download sequence
Identical sequences HGL_H00000251287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]