SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000251343 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000251343
Domain Number 1 Region: 58-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000174
Family Eukaryotic type KH-domain (KH-domain type I) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000251343
Sequence length 664
Comment KHNYN (Homo_sapiens) KH and NYN domain containing
Sequence
MPTWGAGSPTPDRFTVSAEAEEKVRAQQSRLERIFSVGVSVLPKDCPENPHIWLQLEGSK
ENVGRAKEYLKGLCSPELQNEIHYPPRLHCIFLGAQGFFLDCLAWSTSAHLVPGAPGSLM
ISGLTEAFVMAQSRVEDLVDFRPGSYPMTSQSAGVLRDFSALLQPWEDTHTEALLQLPLA
VQEKLLSLVQEASRGHGPLTPASWGGRSPGLLGALHQGVRPSLSEGGESLDAGSVGQGES
RGASGVSHTVENRGKQGGLREVDQGWKELLGEEAWEKEVTFRSQPAGGGTGEMGFLKGMA
LGKEGVPQQRGGSGVQCEPPGAQGHSQKAAQSRGASLLQRLHNGEASPLRVPSPPPAPEP
PWPCGDRGDLGDRGDKQQARGRGSPWKRGTRGGNLVTGTQRFQEALQDPFTLCLANVPGQ
PDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFSKDGKVRE
IHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMLKLAEETSGIIVSNDQFRDLAEESDQ
WMAIIRERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARKQLSSKAQHPSKGFAGYG
NQQQGREEEKGSGGIRKTRETERLRRQLLEVFGGQDHKVDFILQREPYCRDINQLSEALL
SLNF
Download sequence
Identical sequences G5BDS1
XP_004864126.1.39548 XP_004864128.1.39548 XP_004864129.1.39548 HGL_H00000251343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]