SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000251968-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000251968-2
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily UBC-like 0.00000000000000494
Family UEV domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 145-173
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000216
Family VPS23 C-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  HGL_H00000251968-2
Domain Number - Region: 83-132
Classification Level Classification E-value
Superfamily Tropomyosin 0.0484
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000251968-2
Sequence length 175
Comment TSG101 (Homo_sapiens) tumor susceptibility gene 101
Sequence
MVVLESQLKKMVSKYKYRDLTVCETVNVITLYKDLKSVLDSYVFNDGSSRELMNLTRTIP
VLYRGNTYNIPICLWLLDTYPYEDLKKGLQKLEEMVTRLDQEVPEVDKNTELLKKKDEEL
SSALEKMENQSENNDIDEVIIPPAPLYKQILNLYAEENAIEDIIFYLGEALRGKS
Download sequence
Identical sequences G5AZ94
HGL_H00000251968-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]