SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252172 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252172
Domain Number 1 Region: 55-839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-289
Family Motor proteins 1.27e-17
Further Details:      
 
Domain Number 2 Region: 1242-1360
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.75e-27
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number 3 Region: 840-964
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-24
Family Myosin rod fragments 0.00000212
Further Details:      
 
Domain Number 4 Region: 962-1079
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-18
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 5 Region: 1437-1557
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000000732
Family Myosin rod fragments 0.0066
Further Details:      
 
Domain Number 6 Region: 1076-1190
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000183
Family Myosin rod fragments 0.0038
Further Details:      
 
Domain Number 7 Region: 1747-1945
Classification Level Classification E-value
Superfamily Tropomyosin 0.000036
Family Tropomyosin 0.00086
Further Details:      
 
Weak hits

Sequence:  HGL_H00000252172
Domain Number - Region: 1563-1661
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0141
Family Myosin rod fragments 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252172
Sequence length 1947
Comment MYH13 (Homo_sapiens) myosin, heavy chain 13, skeletal muscle
Sequence
SDAEMAIFGEAAPYLRKPEKERIEAQNCPFDSKKACFAVDDKEMYVKGMIQSRENDTIIV
KTLDDRMLTLNSNQVFPMNPPKFDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLF
CVTVNPYKWLPVYNPEVVGAYRGKKRQEAPPHIFSISDNAYQFMLTDRDNQSILITGESG
AGKTVNTKRVIQYFATIAVTGDKKKEQQPGKMQGTLEDQIIQANPLLEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLSSERSYHIFYQIMSNKKPELIDL
LLISTNPFDFPFVSQGEVTVASIDDSEELLATDNAIDILGFSSEEKVGIYKLTGAVMHYG
NMKFKQKQREEQAEPDGTEVADKAGYLMGLNSAEMLKGLCCPRVKVGNEYVTKGQNVQQV
TNAVGALAKAVYEKMFLWMVNRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMF
PKATDTSFKNKLYDQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNKDP
LNETVVGLYQKSSLKLLSFLFSNYAGAEAGDARGSKKGGKKKGSSFQTASAVFRENLNKL
MTNLRSTHPHFVRCLIPNETKTPGVMDHYLVMHQLRCNGVLEGIRICRKGFPSRLLYADF
KQRYRILNASAIPEGQFIDSKNASEKLLNSIDVDQEQYRFGHTKVFFKAGLLGLLEEMRD
EKLVTLMTRTQALCRGYLMRVEFKKMMERRDSIFCIQYNIRSFMNVKHWPWMNMYFKIKP
LLKSAEAEKKMATMKEDFERTKEELARSEAHRKELEEKMVSLLQEKNDLQLQVQSETENL
MDAEERCEGLIKSKIQLEAKVKELNERLEEEEETNSDLVAKKRTLEDKCSSLKRDIDDLE
LTLTKVEKEKHATENKVKNLSEEMTALEENISKLTKEKKSLQEVHQQTLDDLQVEEDKVN
SLIKINVKLEQQTDDLEGSLEQEKKLRADLERXXXXXRVKRKLEGDLKMSRESIMDLEND
KQQMEEKLKKKEFEISQLQTKIEDEQVHSLQLQKKIKELQARTEELEEEIEAEHALRAKI
EKQRSDLSRELEEISERLEEASGATSAQIEMNKKREAEFQKLRRDLEEATLQHEATAATL
RKKHADSVAELGEQIDNLQRVKQKLEKEKSELRMEIDDMASNIETVSKSKNNIERMCRSV
EDQFNEIKAKDDHQTQLIHDLNMQKARLQTQNGELCHQTEEKESLISQLTRGKQALTQQL
EELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANSEVAQWR
TKYEANAIQRTEELEDAKKKLAQRLQDAEENTETVNTKCASLEKTKQRLQSEVDDLMLDL
KRANTACAALDKKQRNFDKVLAEWKQKLDVSQAELEAAQKESRSLSTEIFKMKNAYEEVL
EQLEALRRENKNLQEEISDLTEQIAETGKNLQEVEKTKKQVEQEKSDLQAALEEVEASGS
LEHEESKILRVQLELSQVKSELNRKVTEKDEEIEQLKRNNQRAAEAVQSMLEAEVRSRND
ALRLKKKMEGDLNEMEIQLGHSNRQVAETQKHLRKVQGQLKLGPHSWFPQRIPSCTWTRS
NEDLKEQLAIVERRNGLLHEELEEMKVALEQTERTRRLSEQELLDASDRVQLLHSQNTSL
INTKKKLEADLVQCQAEVEHSIQESKNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMK
KNLEQTVKDLQHHLDEAEQLALKGSKKQIQKLEARVRELENELDAEQKRGAEALKGAHKY
EHKVKEITYQAEEDHKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHEL
EEAEERADIAESQVNKLRAKSRDVGSQ
Download sequence
Identical sequences G5B5H9
HGL_H00000252172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]