SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252463 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252463
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-21
Family SCAN domain 0.00023
Further Details:      
 
Domain Number 2 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 3 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-17
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 588-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 284-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000639
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 456-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000883
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 414-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000549
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252463
Sequence length 669
Comment ZSCAN10 (Homo_sapiens) zinc finger and SCAN domain containing 10
Sequence
MGPRASLSRLRELCGHWLQPALHTKEQILELLVLEQFLSVLPQHLLGRLQGQQLRDGEEV
VLLLEGVPRDTGHSGPLDFSFSAGKNYPRTDIILEEQGGPSQISSYSPKKEVPSEEPTAL
LPLKEVPPSQPWPVRPAEPTEWTPAPSSRQLLSPGPQGTLQALPESTLQGPSLWPEEYSR
DQELAAVLESLTFEDVPAKKTWPVHPLGFESRTPDKEEFKMEEPKEAAWPTVTSVESQAD
TPESAGEPLTQTVGHEANGTGGGGTPLGSSVSEGTSESEAKMQFICTECGANFPQLSRLK
KHQLNSHPGSRSFLCLCCGKSFGRSSILKLHMRTHTDERPHACHLCSHRFRQSSHLAKHL
LTHSSEPAFLCAECGRGFQRRSSLVHHLLLHAQDLKPTPTPEAEAKEAEVAVVLCSHCGQ
TFQRRSSLKRHLRIHARDKDRRGAEDSHGLNSGRERRPHACGDCGKAFRRSEHLVTHRRV
HTGERPFSTHGGPRPHRCAQCGKSFSQTQDLARHLRSHTGEKPCRCGECGECFSQSAHLA
RHQRIHTGEKPHACDTCGHRFRNSSNLARHLRSHTGERPYSCPTCDRSFRRNAHLQRHLV
THAGRAQELEAPQECHECGKTFSRSCNLLRHLLVHTGARPYTCAQCGRGFSRNSHLLRHL
RTHARETLY
Download sequence
Identical sequences G5B1I8
HGL_H00000252463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]