SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252542 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252542
Domain Number 1 Region: 417-503
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.9e-23
Family Canonical RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily SAP domain 0.0000000104
Family SAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252542
Sequence length 923
Comment SAFB2 (Homo_sapiens) scaffold attachment factor B2
Sequence
MAEPLAGSGDSGSGTVALGSGPSETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERL
KKAVKEEGQDPDEIGIELETTSKKTAKRCAKGQKMEDEGTEDNGLEEDSRDGQEDVDVSL
ENLQGMGVVGMSVLDEAEDSSAPDFGEDGGGDDSILGPLCDSKEYVAAQLGQLPARLSEH
AVDGEDFENPLEASSLNSKVTPDIEEPLLEPENEKILDILGETCKSEPVKEEGSELEQPF
AQDTSSVGPDRKLAEEEDLFGSAHPEEEEEEEQEEEEEEEEEEGDLDLASESTRAQWSEA
DTLLAVVKREPVEQTGEGARTDCEPVGLEKPVEQSSAASELPEASSQELAEAPTEAPSPE
PRDSKEDVKKFEFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPVIKDEKGRVSSSS
GRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSEEATKCI
SHLHRTELHGRMISVEKAKNEPAGKKLLDRKECEVKKEKLSSADRHHPVEVKIEKTVIKK
EEKTEKKEEKRPEDIKMEEKDQDELKPGPANRSRVTKSGSRGTERTVVMDKSKGEPVISV
KTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQR
EREQRLEAFHERKEKARLERERREELRRQQEQLRYEQERRPALRRPYDLDRRDDAYWPEG
KRVALEDRYRADFPRPDHRFHDFDHRDRGQYQDHSADRREGSRPGMGERDGQHYSDDRHG
HGHGGPPEHHSREHRDGWGGYASDKRLSEGRGLPPPPRGGRDWAEHNPRLEEHPVRAWQG
TVDAGAVGREHSRWPGAERGLSGPSGPGHAASRGGLAGRGGFAQGAHSQGHAVPGGSLEG
GGVTSQDRGSRVPHPYPHFTRRY
Download sequence
Identical sequences G5C0Q9
HGL_H00000252542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]