SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252797 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252797
Domain Number 1 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 25-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-18
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 4 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 175-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252797
Sequence length 408
Comment ZNF764 (Homo_sapiens) zinc finger protein 764
Sequence
MGPPLAQLPPWAPNQAGPKSGEPWAITFADVAVYFSPEEWGCLQPTQRALYRDVMRDTYV
LLSALGGGGAKPALISWVEREAELWDPDAQDPEVPKWPTEADTADCRNKEEKKEKEVPEA
LEKTLSPDSRPPGLKGPQASFVGLPYVLELPSKAHHRGRPPLRAHPSVPRADQRHGCYVC
GKSFAWRSTLVEHLYTHTGEKPFQCPDCGKGFGRASSLSKHRAIHRGERPHCCPNCGRAF
TQRSALTTHLRVHTGEKPYCCADCGRCFSQSSALYQHQRVHSGKTPFPCTDCGRAFAHAS
DLRRHVRTHTGEKPYPCPDCGRCFRQSSEMVAHRRTHSGERPYPCPQCGRCFGQKSAMAK
HQWVHRPRVGGRRGGGGSGLPMPLAPGPRDLDPPVGFQHYPEIFQECG
Download sequence
Identical sequences G5BYL2
HGL_H00000252797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]