SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252985 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252985
Domain Number 1 Region: 174-411
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-38
Family Ankyrin repeat 0.0000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252985
Sequence length 438
Comment NFKBID (Homo_sapiens) nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta
Sequence
VSRNERSHCQTQTVKKLLEEQRRRQQQPDATGGAPGQFSPSPSQPLTTSVNEVEAGHTHF
SALPETLGSGFGSLPPSTGFPDWDPNTHAAYTDSPCSYPASAAEGFLSPDFYPPLDSGRL
GPFPVGMKAGTWRVSGLPSGPPQLLPCMGPSLDTARAHMLAMGPQQLLAQDEEGDTLLHL
FAARGLRWAAYAAAEVLQMYRHLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNATD
HQGRSVLHVAATYGLPSVLSAVFKSGVQVNLEARDFEGLTPLHTAILALNAAMHPPTLCP
RMLSAQARDRLACVQMLLHIGADHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLR
TFVNMKAHGNTALHMAAALPPGPLQESIVRHLLAAGADPTLRNLENEQPIHLLRPGPGPE
GLRQLLKRSRVAPPGLSS
Download sequence
Identical sequences G5BXP3
HGL_H00000252985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]