SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253055 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253055
Domain Number 1 Region: 85-360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.49e-76
Family Protein kinases, catalytic subunit 0.0000223
Further Details:      
 
Domain Number 2 Region: 15-87
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253055
Sequence length 928
Comment MAP3K10 (Homo_sapiens) mitogen-activated protein kinase kinase kinase 10
Sequence
MEEEEGAAAKEWGTTPAGPVWTAVFDYEAVGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPAAPAAPASLGLPQEIPFHELQLEEIIGVGGFGKVYRALWQGE
EVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGACLGPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFSSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKQEEQRRRREQELAEREMDIVEREL
HLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGFEHKITVQASPTLDKRKGS
DGASPPASPSIIPRLRAIRLTPVDCGGGSSSGSSSGGSGTWGRSGPPKKEELVGGKKKGR
TWGPSSTLQKERAGGEERLKALGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAE
VDGGSSVPPSPYSTASYLTVPLPTEPSPGAQALWEPAPAMPSSRLGHGRRRCDLALLGCA
TLLSAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRGLSPPGRLQSRRDDAGPGLG
LAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPSPPSPSSAASPSTNPLVDLELESFKKDP
RQSLTPTHVTATRAVSRGHRRTPSDGALGQRGPPEPAGHGPGPRDPLDFPRLPDPQALFP
TRRRPPDFPGRPTTLTFAPRPRPAGSRPRLDPWKLVSFGRTFSISPPSRPDTPESPGPPS
VQPTLLDMDMEGQSQDNTVPLCGAHGSH
Download sequence
Identical sequences G5AK34
HGL_H00000253055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]