SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253079-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000253079-1
Domain Number - Region: 130-247
Classification Level Classification E-value
Superfamily Prefoldin 0.000706
Family Prefoldin 0.018
Further Details:      
 
Domain Number - Region: 60-151
Classification Level Classification E-value
Superfamily Tropomyosin 0.00464
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253079-1
Sequence length 671
Comment CCDC62 (Homo_sapiens) coiled-coil domain containing 62
Sequence
MRVGPSPGCRSLPGIGSEVENSTIEKQRKELQLLIGELKDRDKELNDMVAVHQRQLLSWE
EDRQRVLTLEERCSKLEGELHKRTEIIRSLMKKVKVLESNQIECQTALQKTQLQLQEMAQ
KATHSSLLSEDLEARNENLSNTLVALSAQVGQLQAREQALTTTIKLKDKDIIEAVNHIAD
CSGKFKLLEHALRDAKMVENSVVKEKQDYKQRLKALKIEVNKLKEDLNEKTTENNEQREE
IIRLKQEKSCLHDELIFTEDLNEKTTENNEQREEIIRLKQEKSCLHDELIFTVEREKRKD
ELLDIAKSKQERTNSELHNLRQIYIKQQSDLQFLNFNVENSQQFIQIYDSKMEESKSLES
SRDMCLWDLENNHPKIDVKREKSSVKDHKFEAVLAQQNWPEKSPCDVCKEKKLQPGTAFA
ESVITLSSLFPKDLTEKPKSWPLGAKTPIEPESKITPRRVHAKFPEDDGPGRQGVYLGLA
CCCCCGPGQAGKLDAEAREALPRSGSPSCAKSQGAPDDRVPGSACKRTCKRAPGVALRRR
PEAAADGAGTTGTNRNRNRPHPGPAAIGLCRPALGELTAIQQSHCLSSSKSATREDETEA
SPGEKSLPTSLLIDRDSTLSTEKDDFSPTSKLQRLLAESRQMVTDLELSTLLPLGCQDPS
GGARTVRVRCR
Download sequence
Identical sequences G5AWR6
HGL_H00000253079-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]