SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253108 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253108
Domain Number 1 Region: 221-323
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-25
Family Canonical RBD 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253108
Sequence length 323
Comment EIF3G (Homo_sapiens) eukaryotic translation initiation factor 3, subunit G
Sequence
MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVI
NGNTKTVTEYKIDEDGKNLDPLPCRLQIVRTFRIETRKASKAVARRKNWKKFGNSEFDPP
GPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKD
TLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQSKTGKYVPPSLRDGASRRGEAMPPNR
RADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDA
GRAIAGVSGFGYDHLILNVEWAK
Download sequence
Identical sequences G5B343
HGL_H00000253108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]