SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253115 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253115
Domain Number 1 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 10-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-22
Family KRAB domain (Kruppel-associated box) 0.00076
Further Details:      
 
Domain Number 3 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 347-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 131-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000186
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000253115
Domain Number - Region: 56-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00291
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253115
Sequence length 398
Comment ZNF426 (Homo_sapiens) zinc finger protein 426
Sequence
GYLAQTSLCVMIQESVSFDDVAVDFTQEEWTLLDPTQRNLYGDVMLENYQNLATVGIHNG
GGLYDWKQCEEFFSEHTCGKTHMKTQSIGDTYDCDQRGKDFLTVQQETSTREKLSAFNRS
GEIFCMSPNVYQRQLFTSTQEKSFECSDCGKSFVNQSHLQAHWEIHSGDKLCEWKEYGGF
INSASLPVLIETLNARKPYKCKECGKGYRYPAYLNIHMRTHTGEKPYECKECGKAFNYSN
SFQIHGRTHTGEKPYICKLCGKAFTQYSGLSIHLRSHSGDKPYECKECGKAFLTSSRLIQ
HIRIHTGEKPFVCVQCGKAFAISSNLSGHLRTHTEEKACECKVCGKVFGYPSCLNNHMRT
HSAPKSYTCKECGKAFNYSTHLKIHMRIHTGEKPYECK
Download sequence
Identical sequences G5B350
HGL_H00000253115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]