SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253329 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253329
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.46e-52
Family Cyclophilin (peptidylprolyl isomerase) 0.0000274
Further Details:      
 
Domain Number 2 Region: 223-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-28
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253329
Sequence length 490
Comment PPIL4 (Homo_sapiens) peptidylprolyl isomerase (cyclophilin)-like 4
Sequence
MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE
PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKSSNLVLKDKVKPKQD
AKYDLILDEQAEDSKSSHSHTSKKHKKKTRHCSEEKEDEDYMPIKNTNQDIYREMGFGHY
EEEESSWEKQKSEKRDRPQDRSRSRSRERDGHYSNSHKSRYQTDGYERERSKKRDRSRSP
KKSKDKSKYR
Download sequence
Identical sequences G5BMC8
XP_004856957.1.39548 HGL_H00000253329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]