SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253363 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253363
Domain Number 1 Region: 250-338,441-505
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-34
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 73-115,147-227
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.99e-19
Family Canonical RBD 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253363
Sequence length 530
Comment RBM39 (Homo_sapiens) RNA binding motif protein 39
Sequence
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRD
RERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKL
SRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMAN
NLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD
SECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLM
ARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQP
LATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPS
IAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Download sequence
Identical sequences A0A0A0MXQ0 A0A1S3EQP1 A0A1U7UJW9 A0A250Y2D9 A0A287BAQ0 A0A2I2Y5B1 A0A2K5CXX5 A0A2K5RHX9 A0A2K6DE08 A0A2K6GW98 A0A2K6N2H6 A0A2K6QF56 B0CM86 B0KWM7 B1MTM9 B5FW58 B7NZJ5 C3PT69 E2R4L0 G1LTR3 G3UFS3 G5B843 H9EMA5 K7BIV1 L8ICP3 M3WUX8 M3Z262 Q14498
gi|35493811|ref|NP_909122.1| ENSPPYP00000012240 ENSP00000253363 ENSP00000253363 ENSDNOP00000015604 ENSTTRP00000016153 9606.ENSP00000253363 9615.ENSCAFP00000012254 9823.ENSSSCP00000007783 ENSCAFP00000012254 ENSMPUP00000017674 ENSCAFP00000012254 HR4730 ENSAMEP00000010460 ENSAMEP00000010460 ENSCJAP00000032412 ENSLAFP00000008664 ENSCJAP00000032412 ENSMPUP00000017674 ENSPANP00000016742 ENSPPYP00000012240 ENSTTRP00000016153 ENSP00000344581 NP_001164806.1.1745 NP_909122.1.87134 NP_909122.1.92137 XP_001501869.1.31192 XP_002747279.1.60252 XP_003316931.1.37143 XP_003360012.1.46622 XP_003411733.1.64505 XP_003501196.1.69978 XP_004062114.1.27298 XP_004272835.1.21590 XP_004326023.1.83887 XP_004370446.1.4749 XP_004393183.1.74151 XP_004430511.1.5094 XP_004482469.1.11602 XP_004585828.1.84141 XP_004612574.1.94378 XP_004687288.1.23501 XP_004746573.1.14098 XP_004867917.1.39548 XP_005214691.1.76553 XP_005384826.1.28644 XP_005688565.1.57651 XP_005968100.1.78601 XP_006072504.1.26621 XP_006144136.1.99106 XP_006188656.1.101512 XP_006202645.1.17985 XP_006746941.1.47382 XP_006746942.1.47382 XP_006875773.1.41390 XP_006881548.1.29581 XP_006921827.1.64745 XP_006988335.1.50099 XP_007101769.1.24612 XP_007193265.1.59432 XP_007447817.1.90284 XP_007616716.1.28591 XP_007932809.1.48129 XP_008072534.1.4292 XP_008254189.1.1745 XP_008523714.1.77740 XP_008838984.1.79516 XP_008838985.1.79516 XP_008955490.1.60992 XP_009231797.1.23681 XP_010384860.1.97406 XP_010638265.1.5607 XP_010853215.1.44457 XP_010959088.1.22495 XP_011219568.1.58354 XP_011279174.1.62641 XP_011376649.1.92234 XP_011764847.1.29376 XP_011784520.1.43180 XP_011827765.1.47321 XP_011970237.1.54773 XP_012310510.1.9421 XP_012420405.1.74151 XP_012521275.1.63892 XP_012610359.1.48125 XP_012866275.1.60039 XP_013207585.1.66349 XP_014706269.1.49734 XP_014926456.1.86478 XP_015004591.1.72884 XP_015336636.1.40921 XP_015982753.1.101085 XP_016802593.1.37143 XP_017368694.1.71028 XP_017508032.1.32401 XP_017742096.1.44346 XP_019314185.1.44245 XP_019510768.1.44202 XP_019588633.1.88060 XP_019827890.1.53367 XP_020013585.1.5219 XP_020749714.1.74333 XP_021496161.1.76796 XP_021544668.1.83697 XP_864959.2.84170 HGL_H00000253363 ENSLAFP00000026681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]