SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253496 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253496
Domain Number 1 Region: 369-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-79
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 197-303
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-33
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 3 Region: 38-91
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-19
Family Fibronectin type II module 0.004
Further Details:      
 
Domain Number 4 Region: 97-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253496
Sequence length 618
Comment F12 (Homo_sapiens) coagulation factor XII (Hageman factor)
Sequence
MRALLLLGSLLVSLESALLAPPPWKAPREHKHSGEELTVGLTVTGEPCHFPFQYHRQLYH
KCIHKGWPGPRPWCATTPNFDQDQEWGYCLEPKKVKDHCSKHNPCQKGGICVNTLSSPHC
LCPEHLTGKYCQREKCFEPQLLRFFHENEIWLKTGSAGVAKCHCKGPDAHCRPMASQACR
TNLCLNGGRCLEVEGHRLCHCPMGHTGPFCDLDTETSCYDGRGLSYRGMARTTVSGAACQ
RWASEATYRNMTAEQALSRGVGHHAFCRNPDNDTRPWCFIWNGNRLSWEYCDLPQCQTPP
PALSTPQVHLGRQDLPRPGPSVLQKLPPTSLAPGIWREGEVLAVREQGQLDCGTSSVLCG
QRLRKRLSSLSRIVGGLVALPGAHPYIAALYWGHNFCSGSLIAPCWVLTAAHCLQNRRPA
PEELTVVLGQDRHNQSCEHCQTLAVRSYRLHEAFSSISYQHDLALLRLQESADGSCARLS
PYVQPVCLPSGASPPSESEAALCEVAGWGHQFEGAEEYSTFLQEAQVPFISLERCSTTEV
HGDAILPGMLCAGFLEGGTDACQGDSGGPLVCEDETAEHRLTLRGIISWGSGCGDRNKPG
VYTDVASYLTWIQKHTAS
Download sequence
Identical sequences G5BQ09
HGL_H00000253496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]