SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253810 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253810
Domain Number 1 Region: 473-802
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.94e-82
Family Ankyrin repeat 0.00000757
Further Details:      
 
Domain Number 2 Region: 21-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-24
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 1068-1140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253810
Sequence length 1904
Comment ANKHD1-EIF4EBP3 (Homo_sapiens) ankyrin repeat and KH domain containing 1
Sequence
MVASLWSEVAGRTSTEAEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHT
VVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSV
PTTDISQLTPPHDQSQVPRVPMHTLAMVVPPQEPDRTSQEYSPALIGVQKGTSKQKSSSL
QVADQDQLPPFHPYQPLECIVEETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIE
ELKKNREEQVQKKKKILKELQKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGV
FPEGEGDGSLPEDHFSELPQVDTILFKDNDVDEQQSSPSAEQIDFVPVQPLSPPQCNFSS
DLGSNGTNSLELQKVSGNQQILGQPHIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDL
IAAVSNRVPTGSNSSSQTTECLTPESCSQTTSNMVSQSMPLVYPSVDIDAHTESNHDTAL
TLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSE
RTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGA
EINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEV
VSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIA
ADKGHYKFCELLINRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKI
TPLMSAFRKGHVKVVQYLVKEVNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQ
QAAEANKNASILLKELDLEKSREESRKQALAAKREKRKEKRKKKKEEQKRKQEEDEENKP
KENSELPEDEDEEENDEDVEQEIPIEPPSATTTTTIGISATSATFTNVFGKKRANVVTTP
STNRKNKKNKTKETPPTAHLILPEQHISLAQQKADKNKINGEPRGGGAGGNSDSDNLDST
DCNSESSSGGKSQELNFTMDVNSTGDRRYPSLLLSSQEEKTIAATPKTQTRSKKLSVPAS
VVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRYAVQLINALIQD
PAKELEDLIPKNHIRTPASTKPIHANFSSGVGTTAASSKNAFPLGAPTLVTSQATTLSTF
QPANKLNKNVPTNVRSSFPVSLPLAYPHPHFALLAAQTMQQIRHPRLPMAQFGGTFSPSP
NTWGPFPVRPVNPGNTNSSPKHNNTTRLPNQNGTVLPSESPGLATASCPITVSSVVAASQ
QLCVTNTRTPSSVRKQLFACVPKTSPPATVISSVTSTCSPLPSVSSAPITSGQVPTTFLP
VTAPQAQLSSQKMESFSAMPPPKEKVPTQDQPITNLCTPSPTANGCSISASNTPGAPETH
PSSSSTPPSSNTQEEAQPSSVSDLSPMSMPFASNSEPVPLTLASPRFVAADNQDTSNLPQ
LAVPAPRVSHRMQPRGSFYSVVPNAAIHQDPQSIFVTNPVPLTTPQGPPAAVQLSSAMNI
MNGSQMHINPANKSLQPFGPATLFNHFSSLFDSSQVPPNQGWGDGPLSSRVAADASFTVQ
SAFLGNSVLGHLENVHPDSSKAPGFRPPSQRVSTSPVERLARIRQGGSVAQAPVGTSFVA
PVGHSGIWSFGVNAVSEGLSGWSQSVIGNHPMHQQLSDPSTFSQHQPMERDDSGMVAPSN
IFHQPIASGFVDFSKGLPISMYGGTIIPSHPQLADVPAGPLFNGLQGADPAWNPMIKVIQ
NSAECTDAQQASLLSSVPALKGEIPSPQLTRPKKKVGQPMVTSPNQRHQDHLRQKVPAGV
QELTHCPDTPLLPPSDSRGHNSNCPTLQAGVAEGAEGDRGRDTR
Download sequence
Identical sequences G5AR66
HGL_H00000253810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]