SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000254166 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000254166
Domain Number 1 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 8 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-17
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 204-228,257-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000557
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 317-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000005
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 401-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000254166
Sequence length 686
Comment ZNF132 (Homo_sapiens) zinc finger protein 132
Sequence
SLQGLVIFEDVALHFSQEEWGLLTVAQRSLYRDVMLENFALISSLGKSSSLTTSTSFPGE
GFVHTEAPSGSLRGLLGERPDECRKFFKYKSFVLHQSAQWREALCVRALRENPVRPTQAY
TSTGRGVWTWVVKDEEAPPKQVKSCGVHVGGQPCSCGEQGDSPATKGLQPQAPLSEGKAR
GSPEHRPALPNPSQKSQGVHATQKPFKCSNCRESFLKAFALLNHLITHPEERHSRCPVGG
SAPTENSALPDDQKDLHEEDAHVCGECGKAFNYASKLRKHQKIHMGIRPFQCSECGKTFS
RKDALALHERTHTGERPYECSRCGKAFSVLSTLIRHRKVHLRERPYECRECGKFFKYNKS
FVLHQRVHTGERPFVCEHCGKTYVTRSGLYQHWKVHTGERPYGCSLCGKTFTTRSYRNRH
QQFHTGERAYTCTEWEKPFECTACSKVFVKSSDLLKHLRTHTGERPYACVQCGKAFSQTS
HLTQHLRIHSGETPYACPACGKAFRHSSSLVRHQRIHTAEKAFRCGDCGKAFSHGSNLSQ
HRKIHAGGRPYACARCGRRFCRNSHLIQHERTHTGEKPFACALCGAAFSQGSSLFKHQRV
HTGEKPFACAQCGRAFSHSSNLTQHRLLHTGERPFRCADCGKAFAKGAVLLSHRRIHTGE
KPFACPQCGRAFRERPALFHHQRVHT
Download sequence
Identical sequences G5B3G0
HGL_H00000254166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]