SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000254321-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000254321-1
Domain Number 1 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 2 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 659-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 703-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-16
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 245-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000015
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 10 Region: 566-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000228
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 11 Region: 2-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000366
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 12 Region: 185-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000323
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  HGL_H00000254321-1
Domain Number - Region: 120-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00651
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000254321-1
Sequence length 764
Comment ZNF700 (Homo_sapiens) zinc finger protein 700
Sequence
MEEWALLDPFQKKLHKDVMWENFRNVASIGRKCDDQQIEDEYRNYWTNLRSADADKCCQD
KLRCQHGEMVCVTPGPDVPMKLLGVKPSESLECGKPLIGHSSPTVPIINNTGLKSYELRG
FKQKLSKYYRHGKASTDFQSFQKHEKTNPEENPYRYKQCEKFYSDGTEGNNAKEKSFVYK
QDIRAFSTANHVQIQERKHSNMNTYICIQCGKELNSHHDIQKHERAHTRTKSYVNKNSWK
TLNNSFGNHERLHVREKHYVCKQCGKGFSTHNYCQRHEKSHTGEKPYVCKQCGKAFITKS
HCRAHEQTHTGEKPYVCKQCGKAFSTHSNSQIHERTHTGEKPYVCQQCGKAFNTRSHCQA
HEKTHTTEKPYVCKQCGKAFKTKRHCKIHESIHTEEKPYICKQCGKAFSTLSYCQRHEQT
HTGEKPYVCKQCGKAFRMQSYCNTHEKTHTREKPYVCKQCGKAFRTQKQCKVHEKIHTGE
KPYACKQCGKTFSRHIYCKKHERTHTGEKPYVCNKCGKAFRTRSEYKIHERSHTGEKPYI
CKQCGKAFRTQSSHKIHGRSHTGEKPYVCKQCGKSFRTLGHRKIHERIHTGEKPYICKQC
GRAFITHTECKIHERTHTGEKPYVCKQCGKAFSMHSLRKIHERIHTGEKPYVCKQCGKAF
STQGDCQKHERIHTGEKPYVCKQCGKAFGRQSHCKTHEKTHSGEKPYVCKQCGNAFSTQN
SCQRHARTHTGEKPYVCKKCGKAFTRHSSCQKHESTHSGEKSFV
Download sequence
Identical sequences G5BI61
HGL_H00000254321-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]