SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000254321-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000254321-2
Domain Number 1 Region: 649-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.01e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-20
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 7 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-19
Family KRAB domain (Kruppel-associated box) 0.00063
Further Details:      
 
Domain Number 9 Region: 177-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 388-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000129
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 126-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000784
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000254321-2
Sequence length 707
Comment ZNF700 (Homo_sapiens) zinc finger protein 700
Sequence
ETVTFEDVAVNFTMEEWTLLNPSQKKLYRDVMRETFRNMTAIGRACDDQEVEEDCRNYWR
NLSNEEVEKCYQYKGWNQYEKIFLWTPVANVHRKEAGSTPADSLACREPLIGHLSQNVPL
IAHTALKPYKYLGSEESHYKCDQRGRNCSDFHSFQKHARTKAGEKPCECDQCGNISYSDV
QIHERNHSEGKPYVCKQCGKAFRTYKYVQIHERNHSGEKPYVCKQCGKAFSTYGYVQIHE
RLHTGEKPYVCKQCGKAFSTSSNCRTHEKGHTGDKPYKCKQCGKAFSTRGACQTHESIHT
GGKACVCKQCGKAFTTRRFCQIHERAHTGDKPYVCKQCGKAFTAHIYCQRHERVHSGEKP
YVCKQCGKAFTTSGYCRIHERVHTGEKPYVCKQCGKAFSSYRTCYSHERFHSGEKAYECK
QCGKTFSTYGYVQIHERAHTGYKPYECKQCGKAFSTKSACQRHEKAHSGEKPYPCKQCGK
AFTTRRCCQRHERVHTGDKPYACKQCGKAFSTKSACRTHERFHSGEKPYVCKQCGKAFST
YRCCQRHERVHNGEKPYICNQCGNGFTTKSACQTHERVHTGEKPYVCKQCGKAFSSYGTC
KTHERFHTGEKPYVCKQCGKAFSTRRCCQRHERVHSGEKPYVCKQCGKSFSSYSTCKTHE
RFHSGEKPYVCKQCGKAFSTSSHFRTHERIHTGEKPYECKQCGKGFS
Download sequence
Identical sequences G5BP63
HGL_H00000254321-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]