SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000254321-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000254321-4
Domain Number 1 Region: 404-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-19
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 1-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000155
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 198-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000105
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 142-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000124
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000254321-4
Sequence length 710
Comment ZNF700 (Homo_sapiens) zinc finger protein 700
Sequence
VTFEDVAVNFTMEEWALLNPSQKKLYRDVMGETFRSMAAVGHLVNSLSKFLSRHENRTCS
GKSLIWRPILLWLFYFFYSNKAWNQYKEIFLWTPDANMDMKRTGLKPAESLTRRKPLIGH
LSLAVPIIAHTALKPCEYLGYEDKLCKCNEHGRTCSDFQSCQKHARTKAGEKPYEGGQCG
KSYPDLSEGTHPLEKTSLCKKTLKASSTPNDVQIHERNHSGGKCYVCKQRGKAFTRHSAC
KIHEITHTGEKPYVCKQCGKAFSTHGYCEIHERTHTGEKPYVCKECGKAFSTHSYCKRHE
STHTGEKHYACKQCGKAFIRHSTCKIHERIHTGNKPYVCKQCGKAFRTHTYCQIHERTHT
GEKPYVCKQCGKAFRTQSHRKIHERIHTGETPYGCKQCMKAFHTCALQRHERSHTGEKPY
VCKQCGKAFRTQSHRKIHERIHTGEKPYVCKQCGKTFHTRGYCQIHEKTHTGDKPYVCKR
CGKAFRSHRGFQTHERTHTREKPYVCKQCGKAFGAQSYCQIHERIHTGETPYGCKQCGKA
FHTCSALQRHKRSHTGEKPYVCKQCRKTFSRHSECKIHERIHTGEKPYVCKQCGKTFRTH
RYCQLHEKTHTGDKPYVCKQCGKAFRSHRGSQIHEKTHSGDKPYVCKQCEKAFSTQRYCK
GHERIHTGEKPYACKQCGKAFSTHGVSQIHKRTHTGEKPYVCKQCGKAFS
Download sequence
Identical sequences G5BT77
HGL_H00000254321-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]