SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000254799 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000254799
Domain Number 1 Region: 81-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.54e-18
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 246-308,370-434
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.17e-16
Family Canonical RBD 0.0011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000254799
Domain Number - Region: 188-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000464
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000254799
Sequence length 455
Comment GRSF1 (Homo_sapiens) G-rich RNA sequence binding factor 1
Sequence
MMESKHQKQMESIKEMQTDFQEIQNSTESLHSRMSQCEDRISDIEDKIAISDQEKENFFK
IESKATYLEELTVLQEYELAPSKLGEEVDDVFLIRAQGLPWSCTVEDVLNFFQDCKIRNS
EKGIHFLLNRDGKRRGDALIEMESERDVQKALEKHRLYMGQRYVEVYEINNEDVDALMKS
LQVKASPLVNDGVVRLRGLPYSCSEKDIVDFFAGAQQFDHIWGITSPMSSFLIVLLYLRS
VPTGLNIVDITFVMDYRGRRKTGEAYVQFEEPEMASQALMKHREEIGNRYIEIFPSRRNE
VRTHVGSHKGRKVVSSPTAKCITEPDVVFEEHEVNEDIRPMTTFENEKEIELPKEVLEKV
PEAADLGAMPSLHVVHMRGLPFQANAQDIINVCAFFMPLRPVRITMEYSSSGKATGEAHV
HFGSHEDAVAAMLKDRSHVHHRYIELFLNSCPKGK
Download sequence
Identical sequences G5BN02
HGL_H00000254799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]