SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000255136 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000255136
Domain Number 1 Region: 191-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.51e-51
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 11-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.15e-47
Family Canonical RBD 0.0000378
Further Details:      
 
Domain Number 3 Region: 504-599
Classification Level Classification E-value
Superfamily PABC (PABP) domain 7.46e-37
Family PABC (PABP) domain 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000255136
Sequence length 605
Comment PABPC1L (Homo_sapiens) poly(A) binding protein, cytoplasmic 1-like
Sequence
MQAGGQGYPLSSLYVGDLHPDVTEAMLYETFSPVGPILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEVIKGQPIRIMWSQRDPGLRKSGVGNVFIKNLEDSIDSKALYDTFS
TFGNILSCKVACDEHGSRGFGFVHFETNEAAQQAISTMNGMLLNDRKVFVGHFKSHRERE
AELGAQALAFTNIYVKNLHVDMDEQGLQDLFFEFGKMLSVKVMRDNSGHSRGFGFVNFEK
HEEAQKAVDHMNGKEVSGQQLYVGRAQKRGERQNELKRRFEQMKQDRQTRYQGVNLYVKN
LDDSISDEKLRTVFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGCIVGT
KPLYVALAQRKEERKAILTNQYMQRLSTVQALGRPVMGSFQQPNSYFLPAVAQPPAQATC
YGGSGSVAPVQPAPRWTAQPQRASLVRPPGLPRRPRAHVSSVRQASTQVPYLAPHTKKVA
NIGTQTMGASRACSTEGPSLSAVLTAHGVPEPAVHVPGQEPLTASMLAAAPLHEQKQMIG
ERLYRLIPEVYAALAGKITGMLLEIDNSELLLMLESPESLQAKVEEAVAVLQAHQAMEQP
KEYMH
Download sequence
Identical sequences G5BB29
HGL_H00000255136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]