SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000255381 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000255381
Domain Number 1 Region: 57-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-290
Family Motor proteins 5.51e-18
Further Details:      
 
Domain Number 2 Region: 1238-1356
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.16e-28
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 3 Region: 842-966
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.57e-27
Family Myosin rod fragments 0.00000128
Further Details:      
 
Domain Number 4 Region: 964-1074
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.84e-24
Family Myosin rod fragments 0.0013
Further Details:      
 
Domain Number 5 Region: 1433-1555
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000191
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number 6 Region: 1073-1186
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000602
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number 7 Region: 1618-1807
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000255381
Domain Number - Region: 1740-1934
Classification Level Classification E-value
Superfamily Tropomyosin 0.000235
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 1355-1432
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000255381
Sequence length 1939
Comment MYH4 (Homo_sapiens) myosin, heavy chain 4, skeletal muscle
Sequence
MSSDSEMAVFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVVEPKESYVKATVQSREGGKV
TAKTEGGATLTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPEVVGAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVAGEKKKEEAPSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPEL
IEMLLITTNPYDFAYVSQGEITVPSIDDQEELMATDSAVDILGFSADEKAAIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNSVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNTLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDNSFKNKLYEQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIIGWLDKN
KDPLNETVVGLYQKSGLKTLAFLFVGGQAAEAEGGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLEEM
RDEKLAQLITRTQAMCRGYLMRVEFRKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMATMKEDFEKAKEDLAKSEAKRKELEEKMVALMQEKNDLQLQVQAEAD
GLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDK
VNTLTKAKVKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDVENDKQQL
DEKLKKKEFEMSNLQSKIEDEQALAMQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKH
ADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVAKAKANLEKMCRTLEDQL
SEVKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELK
RQLEEESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRALSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERTN
AACAALDKKQRNFDKILAEWKQKYEETQAEFEASQKESRSLSTELFKVKNAYEESLDQLE
TLKRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQIDQEKSELQAALEEAEASLEHEEG
KILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKK
KMEGDLNEMEIQLNHANRQAAEAIRNLRNTQGMLKDTQLHLDDAIRGQDDLKEQLAMVER
RANLMQAEIEELRASLEQTERSRRVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLEARVRELENEVESEQKRNIEAVKGLRKHERRVKELTYQTEE
DRKNVLRLQDLVDKLQSKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQ
VNKLRVKSREVHTKVINEE
Download sequence
Identical sequences G5B5I2
HGL_H00000255381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]